RIC8A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10393S
Artikelname: RIC8A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10393S
Hersteller Artikelnummer: CNA10393S
Alternativnummer: MBL-CNA10393S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1).
Konjugation: Unconjugated
Alternative Synonym: RIC8
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 60626
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDSDPD
Target-Kategorie: RIC8A
Application Verdünnung: WB: WB,1:500 - 1:2000