MVP Rabbit mAb, Clone: [ARC1855], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1039S
Artikelname: MVP Rabbit mAb, Clone: [ARC1855], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1039S
Hersteller Artikelnummer: CNA1039S
Alternativnummer: MBL-CNA1039S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MVP (Q14764).
Konjugation: Unconjugated
Alternative Synonym: LRP, VAULT1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1855]
Molekulargewicht: 99kDa
NCBI: 9961
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLY
Target-Kategorie: MVP
Application Verdünnung: WB: WB,1:100 - 1:500