CORIN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10404S
Artikelname: CORIN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10404S
Hersteller Artikelnummer: CNA10404S
Alternativnummer: MBL-CNA10404S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CORIN (NP_006578.2).
Konjugation: Unconjugated
Alternative Synonym: CRN, ATC2, Lrp4, PEE5, TMPRSS10
Klonalität: Polyclonal
Molekulargewicht: 116kDa
NCBI: 10699
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS
Target-Kategorie: CORIN
Application Verdünnung: WB: WB,1:500 - 1:1000