TREML1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10414S
Artikelname: TREML1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10414S
Hersteller Artikelnummer: CNA10414S
Alternativnummer: MBL-CNA10414S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-162 of human TREML1 (NP_835468.1).
Konjugation: Unconjugated
Alternative Synonym: TLT1, TLT-1, PRO3438, GLTL1825, dJ238O23.3
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 340205
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP
Target-Kategorie: TREML1
Application Verdünnung: WB: WB,1:500 - 1:2000