Exportin 2 (XPO2) Rabbit mAb, Clone: [ARC1856], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1041S
Artikelname: Exportin 2 (XPO2) Rabbit mAb, Clone: [ARC1856], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1041S
Hersteller Artikelnummer: CNA1041S
Alternativnummer: MBL-CNA1041S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060).
Konjugation: Unconjugated
Alternative Synonym: CAS, CSE1, XPO2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1856]
Molekulargewicht: 110kDa
NCBI: 1434
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
Target-Kategorie: CSE1L
Application Verdünnung: WB: WB,1:500 - 1:1000