CD300C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10420S
Artikelname: CD300C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10420S
Hersteller Artikelnummer: CNA10420S
Alternativnummer: MBL-CNA10420S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1).
Konjugation: Unconjugated
Alternative Synonym: LIR, CLM-6, CMRF35, IGSF16, CMRF-35, CMRF35A, CMRF-35A, CMRF35A1, CMRF35-A1
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 10871
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Target-Kategorie: CD300C
Application Verdünnung: WB: WB,1:500 - 1:2000