COLEC12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10422S
Artikelname: COLEC12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10422S
Hersteller Artikelnummer: CNA10422S
Alternativnummer: MBL-CNA10422S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human COLEC12 (NP_569057.1).
Konjugation: Unconjugated
Alternative Synonym: CLP1, NSR2, SRCL, SCARA4
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 81035
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAA
Target-Kategorie: COLEC12
Application Verdünnung: WB: WB,1:500 - 1:2000