JTB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10427S
Artikelname: JTB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10427S
Hersteller Artikelnummer: CNA10427S
Alternativnummer: MBL-CNA10427S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-105 of human JTB (NP_006685.1).
Konjugation: Unconjugated
Alternative Synonym: PAR, hJT, HJTB, HSPC222
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 10899
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Target-Kategorie: JTB
Application Verdünnung: WB: WB,1:500 - 1:2000