SEMA4F Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10432S
Artikelname: SEMA4F Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10432S
Hersteller Artikelnummer: CNA10432S
Alternativnummer: MBL-CNA10432S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-420 of human SEMA4F (NP_004254.2).
Konjugation: Unconjugated
Alternative Synonym: S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 10505
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
Target-Kategorie: SEMA4F
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200