SLC4A5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10436S
Artikelname: SLC4A5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10436S
Hersteller Artikelnummer: CNA10436S
Alternativnummer: MBL-CNA10436S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1042-1121 of human SLC4A5 (NP_597812.1).
Konjugation: Unconjugated
Alternative Synonym: NBC4, NBCe2
Klonalität: Polyclonal
Molekulargewicht: 126kDa
NCBI: 57835
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Target-Kategorie: SLC4A5
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200