LMAN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10440T
Artikelname: LMAN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10440T
Hersteller Artikelnummer: CNA10440T
Alternativnummer: MBL-CNA10440T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-480 of human LMAN1 (NP_005561.1).
Konjugation: Unconjugated
Alternative Synonym: MR60, gp58, F5F8D, FMFD1, MCFD1, ERGIC53, ERGIC-53
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 3998
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH
Target-Kategorie: LMAN1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200