CYC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10449S
Artikelname: CYC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10449S
Hersteller Artikelnummer: CNA10449S
Alternativnummer: MBL-CNA10449S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 85-291 of human CYC1 (NP_001907.2).
Konjugation: Unconjugated
Alternative Synonym: UQCR4, MC3DN6
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 1537
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLK
Target-Kategorie: CYC1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200