FCRL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10452S
Artikelname: FCRL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10452S
Hersteller Artikelnummer: CNA10452S
Alternativnummer: MBL-CNA10452S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-180 of human FCRL3 (NP_443171.2).
Konjugation: Unconjugated
Alternative Synonym: MAIA, FCRH3, IFGP3, IRTA3, SPAP2, CD307c
Klonalität: Polyclonal
Molekulargewicht: 81kDa
NCBI: 115352
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKP
Target-Kategorie: FCRL3
Application Verdünnung: WB: WB,1:500 - 1:2000