PEX6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10459S
Artikelname: PEX6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10459S
Hersteller Artikelnummer: CNA10459S
Alternativnummer: MBL-CNA10459S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 741-980 of human PEX6 (NP_000278.3).
Konjugation: Unconjugated
Alternative Synonym: PAF2, HMLR2, PAF-2, PBD4A, PDB4B, PXAAA1
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 5190
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
Target-Kategorie: PEX6
Application Verdünnung: WB: WB,1:500 - 1:2000