RFWD2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10463S
Artikelname: RFWD2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10463S
Hersteller Artikelnummer: CNA10463S
Alternativnummer: MBL-CNA10463S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2).
Konjugation: Unconjugated
Alternative Synonym: FAP78, RFWD2, CFAP78, RNF200
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 64326
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Target-Kategorie: COP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200