ARAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10466S
Artikelname: ARAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10466S
Hersteller Artikelnummer: CNA10466S
Alternativnummer: MBL-CNA10466S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 834-1133 of human ARAP1 (NP_001128662.1).
Konjugation: Unconjugated
Alternative Synonym: CENTD2, cnt-d2
Klonalität: Polyclonal
Molekulargewicht: 162kDa
NCBI: 116985
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SVDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAEELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQAMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFATFLFVQHDGLVWPSE
Target-Kategorie: ARAP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200