TREM2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10482P
Artikelname: TREM2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10482P
Hersteller Artikelnummer: CNA10482P
Alternativnummer: MBL-CNA10482P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1).
Konjugation: Unconjugated
Alternative Synonym: PLOSL2, TREM-2, Trem2a, Trem2b, Trem2c
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 54209
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Target-Kategorie: TREM2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200