AKR1C2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1048P
Artikelname: AKR1C2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1048P
Hersteller Artikelnummer: CNA1048P
Alternativnummer: MBL-CNA1048P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C2 (NP_995317.1).
Konjugation: Unconjugated
Alternative Synonym: DD, DD2, TDD, BABP, DD-2, DDH2, HBAB, HAKRD, MCDR2, SRXY8, DD/BABP, AKR1C-pseudo
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 1646
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPAL
Target-Kategorie: AKR1C2
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100