SLC22A4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10490S
Artikelname: SLC22A4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10490S
Hersteller Artikelnummer: CNA10490S
Alternativnummer: MBL-CNA10490S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2).
Konjugation: Unconjugated
Alternative Synonym: OCTN1, DFNB60
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 6583
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Target-Kategorie: SLC22A4
Application Verdünnung: WB: WB,1:1000 - 1:2000