FZD6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10503S
Artikelname: FZD6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10503S
Hersteller Artikelnummer: CNA10503S
Alternativnummer: MBL-CNA10503S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human FZD6 (NP_003497.2).
Konjugation: Unconjugated
Alternative Synonym: FZ6, FZ-6, HFZ6, NDNC1, NDNC10
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 8323
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSF
Target-Kategorie: FZD6
Application Verdünnung: WB: WB,1:1000 - 1:2000