MPP6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10509S
Artikelname: MPP6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10509S
Hersteller Artikelnummer: CNA10509S
Alternativnummer: MBL-CNA10509S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-420 of human MPP6 (NP_057531.2).
Konjugation: Unconjugated
Alternative Synonym: MPP6, VAM1, p55T, VAM-1
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 51678
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKID
Target-Kategorie: PALS2
Application Verdünnung: WB: WB,1:1000 - 1:2000