NOMO1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10510S
Artikelname: NOMO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10510S
Hersteller Artikelnummer: CNA10510S
Alternativnummer: MBL-CNA10510S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-1000 of human NOMO1 (NP_055102.3).
Konjugation: Unconjugated
Alternative Synonym: PM5, Nomo
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 23420
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KSVQELRREQQLAEIEARRQEREKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKIT
Target-Kategorie: NOMO1
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:100 - 1:500