Siglec-8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10514S
Artikelname: Siglec-8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10514S
Hersteller Artikelnummer: CNA10514S
Alternativnummer: MBL-CNA10514S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 17-363 of human Siglec-8 (NP_055257.2).
Konjugation: Unconjugated
Alternative Synonym: SAF2, SIGLEC-8, SIGLEC8L
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 27181
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSS
Target-Kategorie: SIGLEC8
Application Verdünnung: WB: WB,1:500 - 1:2000