ApoER2/LRP8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10517S
Artikelname: ApoER2/LRP8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10517S
Hersteller Artikelnummer: CNA10517S
Alternativnummer: MBL-CNA10517S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2).
Konjugation: Unconjugated
Alternative Synonym: MCI1, LRP-8, APOER2, HSZ75190
Klonalität: Polyclonal
Molekulargewicht: 106kDa
NCBI: 7804
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Target-Kategorie: LRP8
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200