P4HA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10538P
Artikelname: P4HA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10538P
Hersteller Artikelnummer: CNA10538P
Alternativnummer: MBL-CNA10538P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human P4HA1 (NP_001017962.1).
Konjugation: Unconjugated
Alternative Synonym: P4HA
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 5033
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: STIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
Target-Kategorie: P4HA1
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200