TRIM24 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10546T
Artikelname: TRIM24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10546T
Hersteller Artikelnummer: CNA10546T
Alternativnummer: MBL-CNA10546T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-820 of human TRIM24 (NP_056989.2).
Konjugation: Unconjugated
Alternative Synonym: PTC6, TF1A, TIF1, RNF82, TIF1A, hTIF1, TIF1ALPHA
Klonalität: Polyclonal
Molekulargewicht: 117kDa
NCBI: 8805
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DGKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRK
Target-Kategorie: TRIM24
Application Verdünnung: WB: WB,1:1000 - 1:2000