MCT4/SLC16A3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10548P
Artikelname: MCT4/SLC16A3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10548P
Hersteller Artikelnummer: CNA10548P
Alternativnummer: MBL-CNA10548P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 371-465 of human MCT4/SLC16A3 (NP_004198.1).
Konjugation: Unconjugated
Alternative Synonym: MCT3, MCT4, MCT 3, MCT 4, MCT-3, MCT-4
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 9123
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: PPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
Target-Kategorie: SLC16A3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200