CDH4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10557T
Artikelname: CDH4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10557T
Hersteller Artikelnummer: CNA10557T
Alternativnummer: MBL-CNA10557T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 757-916 of human CDH4 (NP_001785.2).
Konjugation: Unconjugated
Alternative Synonym: CAD4, RCAD, R-CAD
Klonalität: Polyclonal
Molekulargewicht: 100kDa
NCBI: 1002
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KRREKERHTKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPGDIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMYGGGEED
Target-Kategorie: CDH4
Application Verdünnung: WB: WB,1:1000 - 1:2000