MCM2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1056S
Artikelname: MCM2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1056S
Hersteller Artikelnummer: CNA1056S
Alternativnummer: MBL-CNA1056S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-700 of human MCM2 (NP_004517.2).
Konjugation: Unconjugated
Alternative Synonym: BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 4171
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISK
Target-Kategorie: MCM2
Application Verdünnung: WB: WB,1:500 - 1:2000