PARG Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10577P
Artikelname: PARG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10577P
Hersteller Artikelnummer: CNA10577P
Alternativnummer: MBL-CNA10577P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 777-976 of human PARG (NP_003622.2).
Konjugation: Unconjugated
Alternative Synonym: PARG99
Klonalität: Polyclonal
Molekulargewicht: 111kDa
NCBI: 8505
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
Target-Kategorie: PARG
Application Verdünnung: WB: WB,1:100 - 1:500