SRPRB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10591T
Artikelname: SRPRB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10591T
Hersteller Artikelnummer: CNA10591T
Alternativnummer: MBL-CNA10591T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 57-271 of human SRPRB (NP_067026.3).
Konjugation: Unconjugated
Alternative Synonym: APMCF1, SR-beta
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 58477
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA
Target-Kategorie: SRPRB
Application Verdünnung: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200