MARCH9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10596S
Artikelname: MARCH9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10596S
Hersteller Artikelnummer: CNA10596S
Alternativnummer: MBL-CNA10596S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2).
Konjugation: Unconjugated
Alternative Synonym: MARCH9, RNF179, MARCH-IX
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 92979
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
Target-Kategorie: MARCHF9
Application Verdünnung: WB: WB,1:500 - 1:1000