[KD Validated] MLST8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1059S
Artikelname: [KD Validated] MLST8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1059S
Hersteller Artikelnummer: CNA1059S
Alternativnummer: MBL-CNA1059S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human MLST8 (NP_001186103.1).
Konjugation: Unconjugated
Alternative Synonym: GBL, LST8, POP3, WAT1, GbetaL
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 64223
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSL
Target-Kategorie: MLST8
Application Verdünnung: WB: WB,1:500 - 1:2000