MCM3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA1060S
| Artikelname: |
MCM3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA1060S |
| Hersteller Artikelnummer: |
CNA1060S |
| Alternativnummer: |
MBL-CNA1060S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human MCM3 (NP_002379.2). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
HCC5, P1.h, RLFB, P1-MCM3 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
91kDa |
| NCBI: |
4172 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSG |
| Target-Kategorie: |
MCM3 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000 |
