GCGR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10617T
Artikelname: GCGR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10617T
Hersteller Artikelnummer: CNA10617T
Alternativnummer: MBL-CNA10617T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GCGR (NP_000151.1).
Konjugation: Unconjugated
Alternative Synonym: GGR, GL-R, MVAH
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 2642
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYS
Target-Kategorie: GCGR
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200