[KO Validated] RhoC Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1062S
Artikelname: [KO Validated] RhoC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1062S
Hersteller Artikelnummer: CNA1062S
Alternativnummer: MBL-CNA1062S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoC (NP_001036144.1).
Konjugation: Unconjugated
Alternative Synonym: H9, ARH9, ARHC, RHOH9
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 389
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Target-Kategorie: RHOC
Application Verdünnung: WB: WB,1:500 - 1:1000