MAPKAPK-2/MK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10668T
Artikelname: MAPKAPK-2/MK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10668T
Hersteller Artikelnummer: CNA10668T
Alternativnummer: MBL-CNA10668T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPKAPK-2/MK2 (NP_116584.2).
Konjugation: Unconjugated
Alternative Synonym: MK2, MK-2, MAPKAP-K2
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 9261
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Target-Kategorie: MAPKAPK2
Application Verdünnung: WB: WB,1:500 - 1:2000