AscL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10669P
Artikelname: AscL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10669P
Hersteller Artikelnummer: CNA10669P
Alternativnummer: MBL-CNA10669P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human AscL1 (NP_004307.2).
Konjugation: Unconjugated
Alternative Synonym: ASH1, HASH1, MASH1, bHLHa46
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 429
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: ANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Target-Kategorie: ASCL1
Application Verdünnung: WB: WB,1:100 - 1:500