CRTC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10682P
Artikelname: CRTC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10682P
Hersteller Artikelnummer: CNA10682P
Alternativnummer: MBL-CNA10682P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-126 of human CRTC2 (NP_859066.1).
Konjugation: Unconjugated
Alternative Synonym: TORC2, TORC-2
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 200186
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: ASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHID
Target-Kategorie: CRTC2
Application Verdünnung: WB: WB,1:100 - 1:500