AKR1A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1068S
Artikelname: AKR1A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1068S
Hersteller Artikelnummer: CNA1068S
Alternativnummer: MBL-CNA1068S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human AKR1A1 (NP_006057.1).
Konjugation: Unconjugated
Alternative Synonym: ALR, ARM, DD3, ALDR1, HEL-S-6
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 10327
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQV
Target-Kategorie: AKR1A1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200