CACNA1H Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10697P
Artikelname: CACNA1H Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10697P
Hersteller Artikelnummer: CNA10697P
Alternativnummer: MBL-CNA10697P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1890-2030 of human CACNA1H (NP_066921.2).
Konjugation: Unconjugated
Alternative Synonym: ECA6, EIG6, HALD4, Cav3.2, CACNA1HB
Klonalität: Polyclonal
Molekulargewicht: 259kDa
NCBI: 8912
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SARRVDADRPPLPQESPGARDAPNLVARKVSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDS
Target-Kategorie: CACNA1H
Application Verdünnung: WB: IF/ICC,1:50 - 1:200