TNFRSF17 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10707P
Artikelname: TNFRSF17 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10707P
Hersteller Artikelnummer: CNA10707P
Alternativnummer: MBL-CNA10707P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFRSF17 (NP_001183.2).
Konjugation: Unconjugated
Alternative Synonym: BCM, BCMA, CD269, TNFRSF13A
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 608
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
Target-Kategorie: TNFRSF17
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200