HNRNPDL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10721S
Artikelname: HNRNPDL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10721S
Hersteller Artikelnummer: CNA10721S
Alternativnummer: MBL-CNA10721S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 261-420 of human HNRNPDL (NP_112740.1).
Konjugation: Unconjugated
Alternative Synonym: HNRNP, JKTBP, HNRPDL, JKTBP2, LGMD1G, LGMDD3, laAUF1
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 9987
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: NIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
Target-Kategorie: HNRNPDL
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100