beta-arrestin1 Rabbit mAb, Clone: [ARC2370], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA10742S
Artikelname: beta-arrestin1 Rabbit mAb, Clone: [ARC2370], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA10742S
Hersteller Artikelnummer: CNA10742S
Alternativnummer: MBL-CNA10742S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta-arrestin1 (P49407).
Konjugation: Unconjugated
Alternative Synonym: ARB1, ARR1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2370]
Molekulargewicht: 47kDa
Sensitivitaet: 1.333 mg/mL
NCBI: 408
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
Target-Kategorie: ARRB1
Application Verdünnung: WB: WB,1:500 - 1:2000