Bak Rabbit mAb, Clone: [ARC0014], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA10754P
Artikelname: Bak Rabbit mAb, Clone: [ARC0014], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA10754P
Hersteller Artikelnummer: CNA10754P
Alternativnummer: MBL-CNA10754P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 11-82 of human Bak (NP_001179.1).
Konjugation: Unconjugated
Alternative Synonym: BAK, CDN1, BCL2L7, BAK-LIKE
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0014]
Molekulargewicht: 23kDa
NCBI: 578
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: RQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIG
Target-Kategorie: BAK1
Application Verdünnung: WB: WB,1:100 - 1:500