WHRN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10773T
Artikelname: WHRN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10773T
Hersteller Artikelnummer: CNA10773T
Alternativnummer: MBL-CNA10773T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 708-907 of human WHRN (NP_056219.3).
Konjugation: Unconjugated
Alternative Synonym: WI, CIP98, USH2D, DFNB31, PDZD7B
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 25861
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PSGHPDQTGTNQHFVMVEVHRPDSEPDVNEVRALPQTRTASTLSQLSDSGQTLSEDSGVDAGEAEASAPGRGRQSVSTKSRSSKELPRNERPTDGANKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
Target-Kategorie: WHRN
Application Verdünnung: WB: WB,1:500 - 1:2000