ZP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10776T
Artikelname: ZP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10776T
Hersteller Artikelnummer: CNA10776T
Alternativnummer: MBL-CNA10776T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 340-610 of human ZP1 (NP_997224.2).
Konjugation: Unconjugated
Alternative Synonym: OOMD, ZPB1, OOMD1, HEL163, OZEMA1
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 22917
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AGDQLIYENWLVSGIHIQKGPQGSITRDSTFQLHVRCVFNASDFLPIQASIFPPPSPAPMTQPGPLRLELRIAKDETFSSYYGEDDYPIVRLLREPVHVEVRLLQRTDPNLVLLLHQCWGAPSANPFQQPQWPILSDGCPFKGDSYRTQMVALDGATPFQSHYQRFTVATFALLDSGSQRALRGLVYLFCSTSACHTSGLETCSTACSTGTTRQRRSSGHRNDTARPQDIVSSPGPVGFEDSYGQEPTLGPTDS
Target-Kategorie: ZP1
Application Verdünnung: WB: WB,1:500 - 1:2000