ARPC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10791T
Artikelname: ARPC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10791T
Hersteller Artikelnummer: CNA10791T
Alternativnummer: MBL-CNA10791T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ARPC2 (NP_690601.1).
Konjugation: Unconjugated
Alternative Synonym: ARC34, PRO2446, p34-Arc, PNAS-139
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 10109
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYH
Target-Kategorie: ARPC2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200