MELK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10794T
Artikelname: MELK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10794T
Hersteller Artikelnummer: CNA10794T
Alternativnummer: MBL-CNA10794T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 412-651 of human MELK (NP_055606.1).
Konjugation: Unconjugated
Alternative Synonym: HPK38
Klonalität: Polyclonal
Molekulargewicht: 75kDa
NCBI: 9833
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
Target-Kategorie: MELK
Application Verdünnung: WB: WB,1:500 - 1:2000