MTMR3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10806T
Artikelname: MTMR3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10806T
Hersteller Artikelnummer: CNA10806T
Alternativnummer: MBL-CNA10806T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 640-810 of human MTMR3 (NP_066576.1).
Konjugation: Unconjugated
Alternative Synonym: ZFYVE10, FYVE-DSP1
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 8897
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVL
Target-Kategorie: MTMR3
Application Verdünnung: WB: WB,1:500 - 1:2000